SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim01g059870.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim01g059870.0.1
Domain Number 1 Region: 416-593
Classification Level Classification E-value
Superfamily GAF domain-like 1.77e-58
Family Phytochrome-specific domain 0.00021
Further Details:      
 
Domain Number 2 Region: 209-405
Classification Level Classification E-value
Superfamily GAF domain-like 6.13e-51
Family GAF domain 0.00000876
Further Details:      
 
Domain Number 3 Region: 85-199
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.53e-25
Family BphP N-terminal domain-like 0.005
Further Details:      
 
Domain Number 4 Region: 972-1118
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.22e-18
Family Histidine kinase 0.0059
Further Details:      
 
Domain Number 5 Region: 627-734
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000161
Family Flavin-binding PAS domain 0.092
Further Details:      
 
Domain Number 6 Region: 770-873
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000454
Family Flavin-binding PAS domain 0.094
Further Details:      
 
Domain Number 7 Region: 887-953
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000314
Family Homodimeric domain of signal transducing histidine kinase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim01g059870.0.1
Sequence length 1131
Sequence
MASGSRTKHSYHNSSQGQAQSSGTSNMNYKDSISKAIAQYTADARLHAVFEQSGESGKSF
DYSQSVKTTTQSVPERQITAYLTKIQRGGHIQPFGCMIAVDEASFRIIAYSENACEMLSL
TPQSVPSLDKSEILTVGTDVRTLFTPSSSVLLERAFGAREITLLNPIWIHSKNSGKPFYA
ILHRVDVGIVIDLEPARTEDPALSIAGAVQSQKLAVRAISHLQSLPGGDIKLLCDTVVES
VRELTGYDRVMVYKFHEDEHGEVVAESKRSDLEPYIGLHYPATDIPQASRFLFKQNRVRM
IVDCHATPVRVTQDESLMQPLCLVGSTLRAPHGCHAQYMANMGSIASLTLAVIINGNDEE
AVGGGRNSMRLWGLVVGHHTSVRSIPFPLRYACEFLMQAFGLQLNMELQLASQLSEKHVL
RTQTLLCDMLLRDSPPGIVTQSPSIMDLVKCDGAALYYQRKYYPLGVTPTEAQIKDIVEW
LLAYHGDSTGLSTDSLADAGYPGAASLGDAVCGMAVAYITSKDFLFWFRSHTAKEIKWGG
AKHHPEDKDDGQRMHPRSSFKAFLEVVKSRSSPWENAEMDAIHSLQLILRDSFKDAEASN
SKAIVHALGEMELQGIDELSSVAREMVRLIETATAPIFGVDVNGRINGWNEKVVELTGLS
AEEAKGKSLVHDLLYKESQESAEKLLYNALRGVEGKNVEIKLRTFGAEQVEKAVFLVVNA
CSSRDYTNSIVGVSFVGQDVTGEKIVMDKFIHIQGDYKAIVHSPNPLIPPIFASDENTSC
SEWNTAMEKLSGWSREEIVGKMLVGEIFGSCCRLKGPDAMTKFMIVLHNAIGGQDTDKFP
FSFFDRNGKYVQALLTANKRVNMEGDTIGAFCFIQIASPELQQALRVQRQQEKKCYSQMK
ELAYICQEVKSPLNGIRFTNSLLEATNLTEYQKQYLETSAACERQMSKIIRDVDLENIED
GSLTLEKEDFFLGSVIDAVVSQVMLLLREKGVQLIRDIPEEIKTLTVHGDQVRIQQVLAD
FLLNMVRYAPSPDGWVEIQLRPSMMPISDGATVVHIELRIICPGEGLPPELVQDMFHSSR
WVTQEGLGLSMCRKMLKLMNGEIQYIRESERCYFMIILDLPMTRKGPKSVG
Download sequence
Identical sequences Q9ZS62
Sopim01g059870.0.1 Solyc01g059870.2.1 Solyc01g059870.2.1 NP_001293131.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]