SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim01g060090.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim01g060090.0.1
Domain Number 1 Region: 25-121
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000261
Family Ran-binding domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sopim01g060090.0.1
Sequence length 158
Sequence
MPIVSFFLCVISFFCNIHFLSFLLQRVKVYRLNDDGKWDDQGTGHVTVDYLERSEEPGLL
VTDEDEHETLLLHRISAEDIYRKQEDTIISWRDPEYSTELALSFQETTGCSYIWDSICSV
QRNMQFSSLNYETFHSASSDLRELPPVELSTLPLILKV
Download sequence
Identical sequences K4AWB3
Solyc01g060090.1.1 Sopim01g060090.0.1 Solyc01g060090.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]