SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim01g081400.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim01g081400.0.1
Domain Number 1 Region: 43-142
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000471
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim01g081400.0.1
Sequence length 167
Sequence
MESGSSFGRVSNHSHSYSTMKQPEIESSGITEIDNGEYWPLSGKPYVDLILTKTGVKPSY
SMYLPKKMRSELPSAGARAVPAVLTCGQKKWDMSYGGVKSGHKFCIEWRKFVDDNNLKEG
DGLVFELVECSASKIEFRVQILSGDFPAELKPEDEEGANSDNPILLG
Download sequence
Identical sequences K4AY32
Sopim01g081400.0.1 XP_004229533.1.44838 XP_015072506.1.21931 XP_015072545.1.21931 Solyc01g081400.2.1 Solyc01g081400.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]