SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim02g083680.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim02g083680.0.1
Domain Number 1 Region: 564-656,694-766
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.9e-36
Family Histidine kinase 0.0058
Further Details:      
 
Domain Number 2 Region: 498-576
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.2e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim02g083680.0.1
Sequence length 879
Sequence
MAHNKATYGTTTTLSIESSSPPITPKGSLPERILSKMLGFADFSKRNQSPSRSGSGTPRN
YQVDEELPFDSSICHSSYRGVFVVRLAIMVMLAILIGMLTLLTWHFTRVYTTKSLNTLAF
GLRHELLQRPILRMWNILNSTVEITTAQVKLSEYVIRKYSKPVDQAQQVEQLYESMKDVT
WALFASRKALNSLTINYKNGFVQAFHRDHRSNNTFYIYSDLANYSISNTYDVNLLSSRQG
WNDQTIHNNISAIWYREPLDPSTGERNGKRSIIPPDELINIAGISQVPDGAASWHVAVSK
YTDSPLLSAALPVWDPSNKSIVAVVGVTTALYSVGQLMKEIVEFHSGHIYLTSQEGWLLA
TSTNSPLLMNTTKGPKLMMAIDSEDPVIRSGAECLQKDYGKRLTPSQEVHIENAKLGNQL
YYIDSFYLQLKRLPMVGVIIIPRKYIMGKVDERAIKTLVILISASICILIIGCVCIFVLT
DGVSKEMKLRAELISQLDARRKAEASSNYKSQFLANMSHELRTPMAAVIGLLDILISDGF
LTNEQYATITQIRKCSTALLRLLNNILDLSKVESGKLVLEETEFDLARELEGLVDMFSVQ
CINHNVETVLDLSDDMPKLVKGDSARVVQIFANLISNSLKFTTSGYIILRGWCGSARGGN
FPLNQKDSWSAPKVKLKRQESQGKKFSKKDNKMILWFEVEDSGCGIDPSKWESVFESFEQ
ADPSTTRLHGGTGLGLCIVRTLVNKMGGEIKVVKKNGPGTVMQLCLQLNCPAEVAGQHFQ
FSFEEHKMRVLLALNGKMGRVIMSQWLERNGVHTWGASDWNELTQILQGISISRCHLKDT
TCECLEPEDLSIQDPDASSPFVIVVDIGILDLICMDSLP
Download sequence
Identical sequences K4BAN6
Solyc02g083680.1.1 Sopim02g083680.0.1 Solyc02g083680.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]