SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim05g015610.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim05g015610.0.1
Domain Number 1 Region: 491-583,635-706
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.39e-38
Family Histidine kinase 0.0066
Further Details:      
 
Domain Number 2 Region: 883-1025
Classification Level Classification E-value
Superfamily CheY-like 1.12e-30
Family CheY-related 0.014
Further Details:      
 
Domain Number 3 Region: 424-503
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.92e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0027
Further Details:      
 
Weak hits

Sequence:  Sopim05g015610.0.1
Domain Number - Region: 734-862
Classification Level Classification E-value
Superfamily CheY-like 0.000228
Family CheY-related 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim05g015610.0.1
Sequence length 1032
Sequence
MSLFYVIGFGLKLGSLILTLCCWFLSLIFSMNGEVMTSSKTLLGDGEHIVKKLWDLSAKI
YHCYPQYVGNRKVGNKWWRKLLIVWLLFWIVVSFSVLWYMNSKAVEKRKETLTSMCDERA
RMLQDQFNVSMNHVQAMSILISTFHHARNPSAIDQCTFASYTERTAFERPLTSGVAYAVR
VLHSERKEFEKRHGWSIKRMDTREPTPVHKDNEYDRDGLEPSPIQAEYAPVIFAQDTIAH
VISVDMLSGKEDRENVLRARESGKGVLTAPFRLLKTNRLGVIKTFAVYKTDLPSNATPNE
RIQATDGYLGGVLDIESLVEKLLQQLASKQTILVNVYDTTNISHPISMYGSNVSGDGLEH
VSALNFGDPFRRHEMRCRFKQKPPWPWLAITTATGILIIALLIGQIFHATINRIAKVEDD
YHQMMMLKKRAEAADVAKSQFLATVSHEIRTPMNGVLGMLHMLTDTNLDVTQQDYVSTAQ
ASGKALVSLINEVLDQAKIESGKLELDAVCFDVRDTLDEVLSLFSGKSQEKGVELAGYIS
DKVPDVLIGDPGRFRQIITNLVGNSIKFTEKGHIFVTVHLVEEVTESAEEFKVNSLFKST
LSGSPVADKRQSWRSFMGFNQEGSSFTSSSSDQINLMVSVEDTGVGIPLDAQSRIFTPFM
QVGPSIARTHGGTGIGLSISKCLVQLMKGEIGFVSLPKIGSTFTFTAVFTNSRNNWNEKK
SQQINNQSNSISSDFHGLRALIVDPRTVRARVSQYHMKRLGVHTEVVSDLNRGLSHVRTE
NGVTNMILIEQEVWDADLGKSSLFVKNLRKINASSSPKLFILANSINSSRAGVSVNGFPT
PFIIMKPLRASMLAASLQRAMGVGNKGNCTNGELSGISLSKLLQGRKILIVDDNNVNLRV
AAAALKKYGADVICTDSGKKALTFLQPPHQFDACFMDIQMPEMDGFQATKIIREMESDIN
SRIKLGQLPPEAYGNVSSWKVPILAMTADVIQATNELCQKCGMDGYVSKPFEAEQLYEEV
SRFFQIKPTQNT
Download sequence
Identical sequences K4BYS7
Solyc05g015610.2.1 Solyc05g015610.2.1 Sopim05g015610.0.1 XP_004239224.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]