SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim05g053410.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim05g053410.0.1
Domain Number 1 Region: 414-591
Classification Level Classification E-value
Superfamily GAF domain-like 9.81e-55
Family Phytochrome-specific domain 0.0002
Further Details:      
 
Domain Number 2 Region: 208-403
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-50
Family GAF domain 0.0000126
Further Details:      
 
Domain Number 3 Region: 84-196
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.97e-22
Family BphP N-terminal domain-like 0.0077
Further Details:      
 
Domain Number 4 Region: 626-741
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000401
Family Flavin-binding PAS domain 0.053
Further Details:      
 
Domain Number 5 Region: 968-1114
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000000172
Family Histidine kinase 0.0093
Further Details:      
 
Domain Number 6 Region: 767-871
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000314
Family Heme-binding PAS domain 0.055
Further Details:      
 
Domain Number 7 Region: 883-949
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000785
Family Homodimeric domain of signal transducing histidine kinase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sopim05g053410.0.1
Sequence length 1121
Sequence
MASGSGSRGKHDRNHQPKNQSQFSGTSNTNALSKAVAQYTTDARLHAAFEQSGESGKNFD
YSQSVRNSTESVTEHQITAYLNKMQRGGHIQPFGCTIAVEEASFCVIAYSENACEMLDIM
PQSVPSLEKNEILKIGTDVRTLFSSSSSGLLEGAFGAREITLLNPIWVHSKNSGKPFYAI
LHRIDVGIVIDLEPARTEDPALSIAGAVQSQKLAVRAISLLQSLPGGDIDLLCDTVVKSV
RELTGYDRVMVYKFHDDEHGEVVAESRRSDLEPYIGLHYPATDIPQASRFLFKQNRVRMI
VDCTAIPVRVIQDESLMQPLCLVGSTLRAPHGCHPQYMVNMGNVASLTLAVVINGNDDEV
VGGRNAMRLWGLVVGHHSSARFIPFPLRYACEFLMQAFGLQLNMELQLASQLAEKRVLRT
QTVLCDMLLRDSPTGIVTQNPSIVDLVKCDGAALYYQGRYYPLGITPTAAQIKGIVEWLL
TCHVDSTGLSTDSLADAGYPEAASLGAAVCGMAVAYVTSKYFLFWFRSHTASEIKWGGAK
HHPEDKDDWQKMHPRSSFKAFLEVVKNRSLPWENAEMDAIHSLQLILRDSFKDASNSKSI
VRVQLREEGLQGMDELRSVAREMVRLVETATAPIFAVDVEGRINAWNAKVAELTELSVEE
AIGKSLVHDLVHEESQTTAQNLLRKALRGEEDKNIEIKLRTFGAEQLKKTVFVEVNACSN
KDYTNNIVGVSFIGQDITAQKVVLDKFVRIQGDYKAIMHSPNPLIPPIFVSDENTCCFEW
NTAMEKLSGWNKEEIIGKMLVGEIFGTFCRLKGPDDMTNFMIMLHKAIGGQEIDKFPFSF
SDRNGKFVQALLTANKRVNVDGQIIGAFCFLQIASPELQKTLMQRQQEKTSNIHMKELAY
ICRELKNPLNGIRFTNSLLEATELTENQKQFLETSAACERQMSKIIRDIDLDNIEDGSLE
LEKGEFFLASVIDAVVSQVMLLLRERGVQLIRDIPDEIKTLRVYGDQVRIQQVFADFLQI
MASYAPPREGWVEVHLRPSIKQISDGVTIVHIEFRIVCPGEGLPPELIQDMFHNSLWVTQ
QGLGLSMCRRILQLMNGQVQYIRESERCFFLIILQLPMLIQ
Download sequence
Identical sequences Q9SWS6
Solyc05g053410.2.1 Solyc05g053410.2.1 Sopim05g053410.0.1 NP_001317100.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]