SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim05g055070.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sopim05g055070.0.1
Domain Number - Region: 144-207
Classification Level Classification E-value
Superfamily GAF domain-like 0.000183
Family GAF domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sopim05g055070.0.1
Sequence length 746
Sequence
MATDSEFSNCNCDEEGVFWNIHTILDCQKVSDFLIAIAYFSIPLELLYFISCSDVPFKWV
LVQFIAFIVLCGLTHLLNGLTYSAHPSFQLIMSLTVAKILTALVSCATAITLLTLFPMLL
KVKVRELFLTQNVLELDQEVGMMKKQKEVYTHVRMLTREIRKSLDKHTILYTTLVELSKT
LNLQNCAVWMPNEDRSLMNLTHGLSPGSAVEYHRSLPIEXSGCVRDNKEQRSENFKTRFG
SCSCKQWRAWXAMYCCSDXDAVALCFGFQRWDTXVGXHSICYFSFGYSGCKXXLXPXXDG
DSGSSCXSGGCGPIPRNSSXRVTINEGETRSEEWFAATGXGECCEGKPGKEFVSEGNEQW
DETANALGFGIAFHTSRXEHKLXSEDYNRHNGENKHRAVKFNKRCNGYTRQRRREIPSRN
DALSAAFTDXRGFLSYXVPVCLXGLSLFHGCSQFFTXSGDGXXEENVSGYTSYGGTSIEY
QLRKGLRCIQGYSGEWNRGREXXASGSKKTXRIXXICYHKIXDXSXSWRFSNRXLNLNFS
LWRKEVQQQRVKGRHEFQHVQKACSNDAGKCMDALKYRWPCTKDDSYSPISXTVIVQKTY
VXACTSFGASDLKLNVQRPPSSTCXXXRRXQNGNQKTASKTRLPSDCCFVWFSVPKCNGT
FNNFHPSCHFGSSHAGNGRIXSDNKGTKIPQSXLAVDHSLIFYFRATSMGQMSTGWNQRS
HTKACSPARNGXRASKSVTKSWXRLL
Download sequence
Identical sequences Sopim05g055070.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]