SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim06g082530.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sopim06g082530.0.1
Domain Number - Region: 419-460
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0785
Family GntR ligand-binding domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sopim06g082530.0.1
Sequence length 653
Sequence
MNTSSHFPGDHRSSDGFEFGHCCGGGGDNDVVCFSSRRSSEEEVVIGSGSDRTVVQGDYF
DGVFKYIHQMLMEDQEDLENRPCMFQDCIALQAAEKSFYDALNPPTIHRDFVDDSGNQFQ
DDYCDAVNHQFAETTFNSDLDNDQFSFFYNTNTICHGVGDGISVVNGDTSNAVNYHQKGE
NENKKHTRDENSESSKGRKSKQLASNGTEDGKTEEHYDKALLCPGLNPSFYENHQNQQQH
GIMQHGINKRALIXSSLNVEGLAEAKKALRRMKXXILQASXRVARRLQQATTPKHSXRYS
IKLGNILHLLVMLLQDWPIALPMPWKLVLLAEIQHGSQVRKYQLQISXKLIRSTSLLVHS
RGCQTYSPTSLSRSXQVNRRGFIXXILVFYMDFNGLVXYTGFPXGPGDLQSLRSQEXISL
SQVFDQRRELRRQGDVXRSIARDLMFHLSIKQXLRNGMRLKXKIWISIEMKSSWXIVCTG
XRMSLMKQXKXHTTTKIQEMLFSTXSRRXILITLSMGSSTLCTMHLSLLQDFERHYSISR
PNLTCLRPQCHEKMKEGXCLSRKYSEEISXTLXLVKGRREWRGLKVTRNGQXGIRXRGLD
NFHWIKTSSRKXKPRXKCSITGIFWWMKIAIGCCKAGKEELCMHSQFGSLFIS
Download sequence
Identical sequences Sopim06g082530.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]