SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim07g045480.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim07g045480.0.1
Domain Number 1 Region: 405-583
Classification Level Classification E-value
Superfamily GAF domain-like 9.81e-59
Family Phytochrome-specific domain 0.00023
Further Details:      
 
Domain Number 2 Region: 198-394
Classification Level Classification E-value
Superfamily GAF domain-like 9.32e-51
Family GAF domain 0.0000116
Further Details:      
 
Domain Number 3 Region: 74-187
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.7e-23
Family BphP N-terminal domain-like 0.0053
Further Details:      
 
Domain Number 4 Region: 955-1107
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000000659
Family Histidine kinase 0.023
Further Details:      
 
Domain Number 5 Region: 617-723
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000102
Family PYP-like 0.046
Further Details:      
 
Domain Number 6 Region: 757-864
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000166
Family Heme-binding PAS domain 0.056
Further Details:      
 
Weak hits

Sequence:  Sopim07g045480.0.1
Domain Number - Region: 892-942
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00392
Family Homodimeric domain of signal transducing histidine kinase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sopim07g045480.0.1
Sequence length 1118
Sequence
MSSSSTTNKTNCSRGSSARSRRSARVIAQTPVDAKLHVEFEESEQQFDYSSSVNLSNSTS
NVPSSTVSDYLQKMQRGSLIQPFGCMIAIDAQNFAVIAYSENAPEMLDLTPHAVPSIEQQ
EALTFGTDVRKLFRSSGASALEKAVSFGELSLLNPILVHCKNSGKPFYAILHRIEVGLVI
DLEPVDPHEVPVTTAGAIKSYKLAAKAIRKLQSLPSGDISLLCDVLVREVSHLTGYDRVM
VYKFHEDEHGEVVAECRTPELEPYLGLHYPATDIPQASRFLFMKNKVRMICDCLAPPIRV
IQDPRLAQSLSLGGSTLRAPHGCHAQYMTNMGTVASMAMSVMINEQDDELDSDQQVGRKL
WGLVVCHHTCPRFLSFPLRYASEFLLQVFSVQVNKEVEMAAQLKEKQILQIQTVLCDMLL
RDAPMGIVTQSPNVMDLVKCDGAALYYRNKLWLHGVTPAESQIRDIAEWLNESHGDSTGL
NTDSLMEAGFPGASVLGDAVCGMAAVKITSKDFLFWFRSHTAKEIKWGGAKHLPGDKDDG
RKMHPRSSFKAFLEVVKRRSLPWEDVEMDAIHSLQLILRGSLQDEAADCSKMIVNVPAVD
TIIDRVDTLHINDMVRLVETASMPVLAVDTSGRINGWNSKVSELTGLPVENVIGVPLVDL
VIGGTTNTIKRVLSLALQGKEEKNVEIKLRTLGPQEKVGSISIVVNACCSRDFKQNIVGV
CFTGKDVTGLKLIKDKYSRVQGDYVGIIHSPSPLIPPIFVMDEQGRCVEWNDAMHKLTGS
KREEVIDQMLLGEVFTVNSFGCRVKDQDTLTQLTILLNRVIAGGEGEKLFFGLFNKQDKY
IEALISANKKVDDDGRVTGVLCFLHVPSPELQYAMHVQKLSEQAAKNSLKKLAYVRLELK
NPLNGINCIQNLLKSSDLSKDQRQLLKTSTMCQKQLAKIIDDTDIESIEECYTEMNSCEF
NLGEVVTVVINQVMILSQERKVQVTWDSPVEVSQLYLIGDNLRLQQVLSDFLTTAILFTP
FEDSSVHFRVIPRKERIGTKMYIMHLEFRITHPSPGIPDDLIQHMFHYSRSISREGFGLY
ISQKLVKIMDGTVQYLREADRSSFIILVEFPLMEKKNN
Download sequence
Identical sequences Q41335
Solyc07g045480.2.1 Sopim07g045480.0.1 NP_001307446.1.44838 Solyc07g045480.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]