SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim07g047770.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim07g047770.0.1
Domain Number 1 Region: 691-784,843-914
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.87e-41
Family Histidine kinase 0.0029
Further Details:      
 
Domain Number 2 Region: 1092-1232
Classification Level Classification E-value
Superfamily CheY-like 1.57e-32
Family CheY-related 0.037
Further Details:      
 
Domain Number 3 Region: 622-703
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.67e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0019
Further Details:      
 
Domain Number 4 Region: 938-1074
Classification Level Classification E-value
Superfamily CheY-like 0.0000000528
Family Receiver domain of the ethylene receptor 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim07g047770.0.1
Sequence length 1235
Sequence
MSLNCKLLGMNGSFSSSFRLKKARESLPGPSCGWKWQRKLLFLWLIFFGIGFFWLVISLN
GDVYSWKKEASELNEDKSYFLLERFNVSKEQIQDLATLFFEKDQISSLECSKVHKHEMPM
STTITCLLKVLGSESLEYEQHEMVVDNIEAEGQCPVPDEETLKNSDISLDEKSLPFVLHR
LSSLISTDPKFFEKKASQIREVGNFNPEHCDSIAFCFTKLCWWVLLGIVISWKILLLCAK
GGEHQQNGFIQQQPLSQQLHPLQQLQQQQVQISCRTGGKWRKKALVIFVFGGVTLAIWLY
LYLSADIALRRKETLTSMCDERARMLQDQFNVSMNHVHALAILVSTFHHGKQPSAIDQKT
FEEYTERTAFERPLTSGVAYALRVRHSEREEFEKLHGWTIKKMEAEDQTLGHDYIPANLD
PAPDQDEYAPVIFSQQTVSHIVSIDMMSGKEDRENILRARASGKGVLTSPFKLLKSNHLG
VVLTFAVYNTHLLPYATPVDRINATVGYIGASYDVPSLVEKLLQQLASKQTIVVNVYDTT
NKFAPIKMYGMDENDTGLLHVSNLDFGDPARSHEMHCRFKQKPSPPWTAITLSVGVLVIT
LLIGHIFHAAINRIAEVEGQYQEMMELKHRAEAADIAKSQFLATVSHEIRTPMNGVLGML
QMLMDTNLDLTQLDYAQTALSSGNELISLINEVLDQAKIESGRLELEAVPFDLRAELDNV
SSLFSGKSHKKGIELAVYVSDLVPEVVIGDSGRFKQIITNLVGNSVKFTNDKGHIFVTVH
LADEVRNPHDVTDEVLKQSLTFVQERSNASWNTFSGFPVVDRWQSWQKFDRLSSTEEEVG
KIKLLVTIEDTGVGIPLEAQARIFTPFMQADSSTSRTYGGTGIGLSISKRLVDLMGGEIG
FFSEPGRGSTFSFTAAFTRGEEGSLERKWKQYDPAFPEFRGLRALVVDDKSIRAVVTRYH
LQRLGICVNITSTMRSACSYLSNYSNTSSLEHLAVVFVDQDSWDKETSLALSNMLKEVRP
NGSTTTLGKPPKICLLCMNFMERAELKIAGIVDHVLTKPVRLSALITCVQEAIGCQNKKQ
VTQPTTLGSLLTGKHILVVDDNNVNRRVAEGALKKYGAIVTCVDSGKAALTHLNPPHKFD
ACFMDLQMPEMDGFEATRQIRNLENKYNEKVNSGELFSGMSARVAHWHTPILAMTADVIQ
ATNEECVKCGMDDYVSKPFEKGQLYSTVARFFGSG
Download sequence
Identical sequences K4CEY3
Solyc07g047770.2.1 Sopim07g047770.0.1 Solyc07g047770.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]