SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim07g056580.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim07g056580.0.1
Domain Number 1 Region: 395-583
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.45e-36
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 608-731
Classification Level Classification E-value
Superfamily CheY-like 3.98e-25
Family Receiver domain of the ethylene receptor 0.0000675
Further Details:      
 
Domain Number 3 Region: 327-407
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Domain Number 4 Region: 160-308
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000436
Family GAF domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sopim07g056580.0.1
Sequence length 736
Sequence
MDCNCFDPLLPADELLMKYQYISDFFIAVAYFSIPIELVYFVQKSAVFPYRWVLVQFGAF
IVLCGATHLINLWTSTPHTRTVAMVMTTAKFSTAAVSCATAVMLVHIIPDLLSVKTRELF
LKNKAAELDREMGLIRTQEETGRYVRMLTHEIRSTLDRHTILKTTLVELGRALQLEECAL
WMPTRTGVELQLSYTLHHQNPVGFTVPIQLPVINQVFSANCAVKISPNSAVARLRPTRKY
IPGEVVAVRVPLLHLSNFQTNDWPELSPKSYALMVLMLPSNSARQWHVHELELVDVVADQ
VAVALSHAAILEESMRARDLLIEQNVALDLARREAETAVRARNDFLGVMNHEMRTPMHAV
VALSSLLQESELIPEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLDVGTFNLHAL
FREVLNLIKPVAAVKKLFVTLSLSSDFPEVAIGDEKRLMQILLNVVGNAVKFSEEGSVSV
SAVNAKSESLIDPRAPEFFPVQSENHFYLRVQVKDTGSGINPQDFPKLFCKFAQNQEPAT
KNSAGTGLGLAICKRFVNLMEGHIWIESEGVGKGSTAIFIVKLGIPGRLNESKLPFTAGL
PANHMQMTFQGLKVLVMDDNGFSRMVTKSLLVHLGCDVTTIGSGDECLRILTREHKVLIM
DVSITGMNCYDVAVSVHEKFGKRLERPLIVALTGNTDQVTKENCLRVGMDGVILKPVSID
KMRSVLSGLLEHGTVL
Download sequence
Identical sequences Sopim07g056580.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]