SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim08g068960.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim08g068960.0.1
Domain Number 1 Region: 427-518,605-681
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.1e-39
Family Histidine kinase 0.0046
Further Details:      
 
Domain Number 2 Region: 871-940,972-1017
Classification Level Classification E-value
Superfamily CheY-like 1.54e-33
Family CheY-related 0.011
Further Details:      
 
Domain Number 3 Region: 372-438
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000184
Family Homodimeric domain of signal transducing histidine kinase 0.0035
Further Details:      
 
Weak hits

Sequence:  Sopim08g068960.0.1
Domain Number - Region: 217-327
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00129
Family BphP N-terminal domain-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim08g068960.0.1
Sequence length 1018
Sequence
MVCEMESDQTEDMEMEVEVLSSMWPEDMNENGKQFNIDWPGEDQDMLEEVNINEDSTIVD
FKRLVELTNYSEKGSSQLAYLVKNWEYKQENAVRLLREELDNLSKQQQESELKKLEILEK
YQFEEERYGGDKRPISILDEDLKRYIFQEAPRKRNDVKIQDKLEIDAEYDSIKYWKQRAT
HLEKLLETSGQREQILTEKLQESIENLERQSSPVEELSQVLKRADNFLHFVLQNAPVVIG
HQDNELRYRFIYNHFPSLREEDIIGKTDVEIFTGAGVKESQDFKREVLERGIPAKREITF
DTGLFGSKTFLIYVEPVFSKAGETLGVNYMGMEITDQVRKREKMAKLREEIAVQKAKETE
LNKTIHITEETMRAKQMLATMSHEIRSPLSGVVSMTEILSTTKLDKEQRQLVNVMLSSGD
LVLQLINDILDLSKVESGVMKLEATKFRPREVVKHVLQTAAASLQKILTLEGHIAEDVPI
EVVGDVLRIRQILTNLISNAIKFTHEGKVGIKLYVVSGPCPDVKQGSHKRMASDHSKVLA
KICKEDKCTSPSNNALDRKGSGGCKDADGANERLLQKGEGNYSEQNGASIEDEVDDPNQQ
ETTVWIRCDVYDTGIGIPENAIPTLFKKYMQVGADTARKYGGTGLGLAICKQLAELMGGH
MTVSSKEHHGSTFTFILPYKVSPVCDSSDDNEELTEMDNHDTSSEGNDDDINSGFFQFQP
RTLGSLFSSHSSGRAPKLSPNGFGYNTLNKTNGFQVNSHSFPLDSNTSKETGSVEDACSV
ADAVETCSDPESTFKHTRNSGNPSTSGREQKINGVLDHTPCLSSPNSETTNSDQGEITEK
IEKSQIQEQPDKSSECSSSKDAQISKTSLKPKILLVEDNKILVMVTRSMMKQLGHDIDIV
NNGVEALRAVQRYRYDLILMDVCMPVMDGLQTTRLIRSYEESGNWDAAKDAGIDVEVSPS
NTSQRSDESSTKRIPIIAMTANAISESAEECYANGMDSFVSKPVTLQKLKESLQQYLP
Download sequence
Identical sequences K4CMB6
XP_010325184.1.44838 XP_010325185.1.44838 Solyc08g068960.2.1 Sopim08g068960.0.1 Solyc08g068960.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]