SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim08g082750.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim08g082750.0.1
Domain Number 1 Region: 882-969
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.18e-22
Family PB1 domain 0.0044
Further Details:      
 
Domain Number 2 Region: 1517-1602
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.21e-17
Family PB1 domain 0.0064
Further Details:      
 
Weak hits

Sequence:  Sopim08g082750.0.1
Domain Number - Region: 1448-1476
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000578
Family FIS-like 0.042
Further Details:      
 
Domain Number - Region: 1058-1134
Classification Level Classification E-value
Superfamily GAF domain-like 0.00368
Family GAF domain 0.013
Further Details:      
 
Domain Number - Region: 189-262
Classification Level Classification E-value
Superfamily GAF domain-like 0.0589
Family GAF domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sopim08g082750.0.1
Sequence length 1611
Sequence
MSEPEEEMNFIFRSKPKDFVHPPPATAAAIFAAAASASNPMSPFLVSAASEQPCSPLWAF
SDENEDKPNGNALSTGSLRLSNYPRFVTYANEHEAAPETVSVTDDKKRIPPPIKGLAPLD
YLDSSCIIKERMTQALRYFKESTGERVLAQVWAPVKNGGRYVLTTSGQPFVLDPDCNGLH
QYRMVSLMYMFSVDGETDGVLGLPGRVYRKKLPEWTPNVQYYSSKEFPRLNHALDYNVRG
TLALPVFEPSGQSCVGVLELIMTSQKINYAPEVDKVCKALEAVNLKSSEILDYPNHQICN
EGRQNALVEILEILTAVCETYKLPLAQTWVPCRHRSVLADGGGFKKSCSSFDGSCMGQVC
MSTTDVAFYVVDAHMWGFREACAEHHLQKGQGVAGRAYASQKSCFCEDIGKFCKTEYPLV
HYARLFGLSRCFAICLRSTHTGNDDYILEFFLPPNDGDYTDQLALLNSLLLTMKQHFRSL
RVASGEELEHDWGSVEIIKASTEEKLGSRFDSVPTTKSLPQSASVANGRRHPDLMEEQHS
TVAKGAEGVNVTAEAHNHASVPQNKQTGKKSERKRGKAEKTISLEVLQQYFAGSLKDAAK
SLGVCPTTMKRICRQHGISRWPSRKINKVNRSLSKLKRVIESVQGADGTFSLTSLAPNSL
PVAVGSISWPAGINGSPCKASEYQEEKNEFSNHGTPGSHEEAEPTDQMLGSRIIGNEELS
PKLNGFVREGSHRSRTGSFSREESTGTPTSHGSCQGSPSPANESSPQNELLNSPTQESVM
KVEGSLEPARQTTGELNLSTAFLMPGLFIPEHTHQQFRGMLVEDAGSSHDLRNLCPAGET
MFDERVPEYSWTNPPCSNGIATNQVPLPVEKMPQFSSRPEVTSVTIKATYREDIIRFRLC
LNSGIYKLKEEVSKRLKLEMGTFDIKYLDDDHEWVLIACDADLQECIDISSSSGSNVVRL
LVHDIMPNLGSSCESSGVKEKIKLALQRIETSQVILLQFWGLENIEGRKFLSTSGQPFGL
RYLYKGLCWYRKHCQGYKYSVDKGENHEQGMEKTHLFGPPTRVFQQKLPESSTHVGYYTN
EEFPMRDHVLQCGVRTYLALPVFEPVDKNCIGVIELVTVWKGGYLTCEVERVLNPLEAVD
LKCPKIFLNKDRKVQAEKYNEGEEFKRMLKIVRETHKLPFIRVWIPCVNLEMDHNGMYVG
CTELAMSASNEVYFVADEEMDANDHVYDDYYYDDMLCFRDISKLQPLQKDQGVVGKAFSS
GKLCYCTNITEFSIIEYPLVHYARWCGLTTSFAICLKSRDDAYILELFLPPDNGDPNMLL
GSILTTMGQHFQNFKFASGQELGNDSSVQVVKASSDKNVDYFHIYQTRDSSFMPEVLHVE
DSRNQLMEGNENHMEKKEDRKQSMVQSNVLSIDSHVISEKQCVSVSHLQKESRTRTKDSV
NYDDLKQHFDKNLSDAAKSLQISRSTLKRLCRKYGIRRWPLSKRKKSSESDQQTLTKVSK
KNKSIGSETTTQKDHESCSSSFTVKATFGDDMMKFKLYTFSRKDDLDNEVSKRLKLPIGR
FRINYMDEDNDWIWIACDDDLSDCFNNAQSLGNNTIKMLVLPAAINHHFEL
Download sequence
Identical sequences K4CPS1
Solyc08g082750.2.1 Solyc08g082750.2.1 Sopim08g082750.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]