SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim09g075440.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim09g075440.0.1
Domain Number 1 Region: 328-407
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.08e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Domain Number 2 Region: 396-485
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000039
Family Histidine kinase 0.0084
Further Details:      
 
Domain Number 3 Region: 161-309
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000414
Family GAF domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sopim09g075440.0.1
Sequence length 635
Sequence
MESCDCIEALLPTGDLLVKYQYLSDFFIAVAYFSIPLELIYFVHKSACFPYRWVLMQFGA
FIVLCGATHFISLWTFFMHSKTVAVVMTISKMLTAAVSCITALMLVHIIPDLLSVKTREL
FLKTRAEELDKEMGLIIRQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLDLAECA
LWMPCQGGLTLQLSHNLNNLIPLGSTVPINLPIINEIFSSPEAIQIPHTNPLARMRNTVG
RYIPPEVVAVRVPLLHLSNFTNDWAELSTRSYAVMVLVLPMNGLRKWREHELELVQVVAD
QVAVALSHAAILEDSMRAHDQLMEQNIALDVARQEAEMAIRARNDFLAVMNHEMRTPMHA
VIALCSLLLETDLTPEQRVMIETILKSSNLLATLINDVLDLSRLEDGILELENGTFNLHG
ILREAVNLIKPIASLKKLSITLALALDLPILAVGDAKRLIQTLLNVAGNAVKFTKEGHIS
IEASVAKPEYARDCHPPEMFPMPSDGQFYLRVQVEILGVELAHKIYHXYSPNLQSHGLRQ
IEVLEGKVXGLPFADDLFNLXKVTFGLRVRALEREPLSRLXXNSESVTIQMHYLCYLCLP
EADXTKVAMISSGIDSSVEMMVGCLXMLNAIKEVC
Download sequence
Identical sequences Sopim09g075440.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]