SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim10g009270.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim10g009270.0.1
Domain Number 1 Region: 215-282
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.06e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  Sopim10g009270.0.1
Domain Number - Region: 11-138
Classification Level Classification E-value
Superfamily GAF domain-like 0.00696
Family GAF domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim10g009270.0.1
Sequence length 393
Sequence
MDEPIFSPSSSQSSLQHRLQYIVKNQTNYCSDWAYIIFWQSSNNRSCLTWGDGHLNMKIT
NNKDVEWFYLMSLAQSFCVGEGVVGKCFSSGSLVWLAGDQQFEFCHCERAKEAHYVHGIN
TFVCIPISSGVLELGSSTMIKQDLNLVQQVKSMFFGYETIDQFDDFGLFNCLELYGEEAK
KGEVVVGTTPHENKAGLKNKTSKKRRREICETQGNHVEAERQRREKLNSRFYALREVVPN
VTKMDKATLLSDAVTYITQLKAKVDELESKLHSNNYHYYYPEMKIKHKMENHDINVVDNQ
SSITTSRDHTMEIEVKMVGQDAMIRVQSENVNYPSTRLMCALQEVELHVYHANISSVNDF
MLHDIVVKVPQGLETEDEVKYALLRSLDQQTCS
Download sequence
Identical sequences K4CYA3
Solyc10g009270.2.1 Solyc10g009270.2.1 Sopim10g009270.0.1 XP_004248095.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]