SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim10g044670.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim10g044670.0.1
Domain Number 1 Region: 409-586
Classification Level Classification E-value
Superfamily GAF domain-like 1.08e-58
Family Phytochrome-specific domain 0.00022
Further Details:      
 
Domain Number 2 Region: 198-398
Classification Level Classification E-value
Superfamily GAF domain-like 2.16e-52
Family GAF domain 0.0000105
Further Details:      
 
Domain Number 3 Region: 74-186
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-23
Family BphP N-terminal domain-like 0.0044
Further Details:      
 
Domain Number 4 Region: 623-729
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000101
Family PYP-like 0.058
Further Details:      
 
Domain Number 5 Region: 956-1113
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000000000473
Family Histidine kinase 0.0087
Further Details:      
 
Domain Number 6 Region: 764-869
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000436
Family Flavin-binding PAS domain 0.026
Further Details:      
 
Weak hits

Sequence:  Sopim10g044670.0.1
Domain Number - Region: 897-949
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00589
Family Homodimeric domain of signal transducing histidine kinase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim10g044670.0.1
Sequence length 1123
Sequence
MSSSRPSQSSTTSSRSKHSARIVAQTSIDAKLHADFEESGDSFDYSSSVRVTSVAGDEEK
PKSDKVTTAYLHQIQKGKFIQPFGCLLALDEKTLKVIAFSENAPEMLTMVSHAVPSVGEH
PVLGIGTDIRTIFTGPSGAALQKALGFGEVSLLNPVLVHCKNSGKPFYAIVHRVTGSLIL
DFEPVKPYEVPMTAAGALQSYKLAAKAITRLQSLPSGSMERLCDTMVQEVFELTGYDRVM
GYKFHEDDHGEVVSEITKPGLEPYLGLHYPATDIPQAARFLFMKNKVRMICDCRAKHVKV
VQDEKLPFDLTLCGSTLRAPHYCHLQYMENMNSIASLVMAVVVNDGDEEGESTDSSQSQK
RKRLWGLVVCHNTTPRFVPFPLRYACEFLAQVFAIHVNKELELENQFLEKNILRTQTLLC
DMLMRDAPLGIVSQSPNIMDLVKCDGAALLYKNKIHRLGMNPSDFQLQDIVSWLCEYHTD
STGLSTDSLYDAGFPGALALGDAVCGMAAVRISDKDWLFWFRSHTAAEVRWGGAKHEPGE
KDDGRKMHPRSSFKAFLEVVKTRSIPWKDYEMDAIHSLQLILRNAFKDAEVVNSNTNSIY
KKLNDLKIDGMQELESVTAEMVRLIETALVPILAVDVDGQVNGWNTKIAELTGLPVDEAI
GKHLLTLVEDSSVDTVNKMLELALQGKEEKNVEFEIKTHGPSRDSSPISLIVNACASKDV
RDNVVGVCFMAHDITGQKSIMDKFTRIEGDYRAIIQNPHPLIPPIFGTDQFGWCSEWNTA
MTKLTGWRRDDVMDKMLLGEVFGTQAACCRLKNQEAFVNFGVVLNNAITGQESEKIPFGF
FARYGKYVECLLCVSKRLDKEGAVTGLFCFLQLASHELQQALYVQRLSEQTALKRLKVLA
YIRRQIRNPLSGIIFSRKMLEGTSLGEEQKNILHTSAQCQRQLNKILDDTDLDSIIDGYL
DLEMLEFKLHEVLVASISQVMMKSNGKNIMISNDMVEDLLNETLYGDSPRLQQVLANFLL
VSVNATPSGGQLSISGRLTKDRIGESVQLALLEFRIRHTGGGVPEELLGQMFGSEADASE
EGISLLVSRKLVKLMNGEVQYLREAGQSTFIISVELAVATNSS
Download sequence
Identical sequences Sopim10g044670.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]