SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim10g078250.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim10g078250.0.1
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily TPR-like 4.51e-18
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sopim10g078250.0.1
Sequence length 91
Sequence
MGEHQEVSKLCSKVIEYDPCNVKALFRRAQAYLRINELEKAEIDINKALEVDPTNRDVKV
MYKELKNKQKQYTQQEVEIFSTMLSKLKTIL
Download sequence
Identical sequences K4D267
Sopim10g078250.0.1 Solyc10g078250.1.1 Solyc10g078250.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]