SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim11g006180.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim11g006180.0.1
Domain Number 1 Region: 636-760
Classification Level Classification E-value
Superfamily CheY-like 4.98e-31
Family Receiver domain of the ethylene receptor 0.0037
Further Details:      
 
Domain Number 2 Region: 187-336
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000807
Family GAF domain 0.0045
Further Details:      
 
Domain Number 3 Region: 354-435
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000216
Family Homodimeric domain of signal transducing histidine kinase 0.0082
Further Details:      
 
Domain Number 4 Region: 438-599
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000129
Family Histidine kinase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sopim11g006180.0.1
Sequence length 767
Sequence
MLAMLRLLFLVLLISLVIISVSANDGEFFNCCDEDGFWSIHTILDCQKVSDFFIAVAYFS
IPLELLYFISRSNLPFKWVLVQFIAFIVLCGLTHLLNGWTYNPHPSFQLILSLTVAKILT
ALVSCATAITLLTLIPLLLKIKVRELFLAQNVLELDQEVGMMKKQTEASMHVRMLTHEIR
KSLDKHTILYTTLVELSKTLKLQNCAVWMPNESRSQMNLTHELSPSSAAESHRSLSINDP
DVLEITKNKGVRILRQDSVLAASSSGGSGEPCAVAAIRMPLLRASDFKGGTPELVDTRYA
ILVLVLSSVDERVWSYDEMEIVEVVADQVAVALSHATVLEESQTMREKLEMRNRVLQQAQ
ENAMKASQARTSFQKVMNNGMRRPMHSILGLLSIFQDEKASSDQRMIVDTMVKTSTVLST
LINDAMEISAKDDGRFPVEMKPFQLHLLVREASCLVKCLCVYKGFGFSTDVPTSLPNQVM
GDEKRTFQVLLHMVGHLLNVSIGKGSVIFRVVLETGAETGNDKVWGTRRPSTTDEYVTIK
FEIEVSLEGSQSDSSISTIHFGGRRHNSKEVTEGLSFNMCKKLVQMMQGNIWMSSNAQGH
AQGMTLILRFQKQSSFRKRMFEYRNPLEQPISSTMFRGLHVLLTDDDDVNRLVTRKLLEK
LGCQVTAVSTGFQCLSALGPSLTTFQVLILDLQMPEMDGYEVALRVRKFRSRSWPLIIAL
TASSEEQVWEKCLQVGMNGLIRKPVLLQGLADELQRLLQRGGGGDGL
Download sequence
Identical sequences Q9XET9
Solyc11g006180.1.1 Solyc11g006180.1.1 NP_001234212.1.44838 Sopim11g006180.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]