SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim12g011330.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim12g011330.0.1
Domain Number 1 Region: 411-599
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.19e-38
Family Histidine kinase 0.0031
Further Details:      
 
Domain Number 2 Region: 624-747
Classification Level Classification E-value
Superfamily CheY-like 1.57e-25
Family Receiver domain of the ethylene receptor 0.0000278
Further Details:      
 
Domain Number 3 Region: 343-423
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.32e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Domain Number 4 Region: 176-324
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000142
Family GAF domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim12g011330.0.1
Sequence length 754
Sequence
MGSLLRMNRLLSSIVESCNCIIDPQLPADDLLMKYQYISDFFIALAYFSIPVELIYFVKK
SAVFPYRWVLVQFGAFIVLCGATHLINLWTFNMHTRNVAIVMTTAKALTALVSCITALML
VHIIPDLLSVKTRELFLKKKAAQLDREMGIIRTQEETGRHVRMLTHEIRSTLDRHTILKT
TLVELGRTLALEECALWMPTRTGLELQLSYTLRHQNPVGLTVPIQLPVINQVFGTNHVVK
ISPNSPVARLRPAGKYMPGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSAR
QWHVHELELVEVVADQVAVALSHAAILEESMRARDLLMEQNVALDLARREAEMAVRARND
FLAVMNHEMRTPMHAIIALSSLLQETDLTPEQRLMVETILKSSNLLATLINDVLDLSRLE
DGSLQLDIGTFNLHALFREVHSLIKPIASVKKLFVTLSLSSDLPEYVIGDEKRLMQILLN
VVGNAVKFSKEGNVSISAFVAKSDSLRDPRAPEFFAVPSENHFYLRVQIKDTGIGITPQD
IPNLFSKFTQSQALATTNSGGTGLGLAICKRFVNLMEGHIWIESEGLGKGSTAIFIIKLG
IPGRANESKLPFVTKLPANHTQMSFQGLKVLVMDENGVSRMVTKGLLTHLGCDVTTVGSR
DECLRVVTHEHKVVIMDVSMQGIDCYEVAVVIHERFGKRHGRPLIVALTGNTDRVTKENC
MRVGMDGVILKPVSVYKMRSVLSELLEHGVVLES
Download sequence
Identical sequences A0A0J9YZQ0
Solyc12g011330.2.1 NP_001234149.1.44838 Solyc12g011330.2.1 Sopim12g011330.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]