SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim01g090290.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sopim01g090290.0.1
Domain Number - Region: 179-224
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0251
Family IMD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sopim01g090290.0.1
Sequence length 259
Sequence
MDIEQKQAEHIDFFVKQASALKGSALTTVIVEATSHPSLFAFSEILSVPSVLELGGTENS
VYLDLLRLFAHGTWSDYKSIAGCLPQLASAQALKLKQLTVLTLADTSKELPYDQLMQELD
VTNVRELEDFLINECMYVGIVRGKLDQLKRCFEVQFAAGRDLRPGQLGNMLQTLTDWLTT
SDNLLVSIQEKIKWADTMSESDRKHRKEVEERVDEVKKSLSLKADVDFRGHEEIYSESGG
VMDYEEDRGRPKRRRHPIG
Download sequence
Identical sequences K4AYX0
Solyc01g090290.2.1 Solyc01g090290.2.1 Sopim01g090290.0.1 XP_004229749.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]