SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim01g097290.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim01g097290.0.1
Domain Number 1 Region: 131-232
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.28e-21
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim01g097290.0.1
Sequence length 251
Sequence
MTSVLGAECDKIRLDYEAETELRLGLPGANGNELESSNKNNGKRVFSETVDLKLNLSNSK
DSTLMDNININQVDNMKEKKNNIVVPSSNDPAKPPAKAQVVGWPPVRSFRKNVMTVQKNT
TGAGEISGTGTGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTQG
FKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA
PRAVEKCKNRS
Download sequence
Identical sequences G9HPW4
NP_001266049.1.44838 Solyc01g097290.2.1 Sopim01g097290.0.1 Solyc01g097290.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]