SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim01g100370.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim01g100370.0.1
Domain Number 1 Region: 9-159
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.09e-38
Family Universal stress protein-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim01g100370.0.1
Sequence length 166
Sequence
MADVAAKERKILIAVDESEESIYALSWCIENILTGNSNDTLILLYSVPPRAVYSTLDGSG
YLFSSDILATMERYSSGVAQCVMEKAKRACEALNGVKVETIVEHGDARDVICQAAEKLHV
DMLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKKPKTDGRSK
Download sequence
Identical sequences K4B171
Solyc01g100370.2.1 NP_001294878.1.44838 Solyc01g100370.2.1 Sopim01g100370.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]