SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim01g110300.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim01g110300.0.1
Domain Number 1 Region: 47-256
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.38e-22
Family BAR domain 0.048
Further Details:      
 
Domain Number 2 Region: 263-357
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-16
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sopim01g110300.0.1
Sequence length 368
Sequence
MEAIRKQATRLREQVARQQQAVLKQFGAGGYGSDLVTDEAEMQQHHKLERLYISTRAAKH
FQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGTTLSKAALGFSRARAQME
KERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQEAEAQAVEVSRRQAKLRE
GTGHPDMAYKLEAAETKLDDLKSNTNTLGKEAAAAMAAVEAQQQRLTLQRLIAMVESERS
YHQRILQILDQLEAEMLSERQRIEAAPAPPLDTMPPPPSYEEVNGVSTSPVQNGSTDNMG
YFLGEVMYPYQAESDVELNLSVGEYIVIRKVSNNGWAEGECKGRAGWFPFGYIERRDRVL
ASKVAEVF
Download sequence
Identical sequences K4B3P3
NP_001309916.1.44838 Sopim01g110300.0.1 Solyc01g110300.2.1 Solyc01g110300.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]