SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim03g118870.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim03g118870.0.1
Domain Number 1 Region: 67-165
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.41e-22
Family PB1 domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim03g118870.0.1
Sequence length 637
Sequence
MDPPPIPSHITATPIGTIAQQNYSDSASSSPRSRQNDTWEQESLALVSGAKLRLICSYGG
HIIPRPHDKSLCYVGGDTRIVVAERQSSLADLQSRLSHTLLNGRRFSLKYQLPNEELDSL
VSVTTDEDLDNMIEEYDRAMSASPLKPSRLRLFLFLAKPETAASMGCLLADSKSETWFVD
ALNNASMLSRGLSDSAAEGNFLELERIPKSDSGVNLDQAQNESLAANNRQMAKNVIQEVQ
STMPDSPMVETTSSFESSVSSPSMPNLPQIKVRAENGQMNARFHDQMPGLDEQFSNMNVA
SNAQNLEDAYLHLAAQAATPPLPTVIGGAAVTSSATLVNAAPATGEHHGRVISDDEKSDH
GAPSGRRKPPLPLQPIQRKVGDAYSLPSPDSKHAGGYNLQSPDSVASDSSIASGTSFSKH
TVYQDAPPATGRETRMHPAVMDYNSQIQMQQVQDSVVMQVPQQNQQQFVPANAHYIQHTA
TGPVAAPSYYQMYAPPTQQPLHQQMDQQYQMYYVPVPQTQQYNLTVQSNVADASAVASNQ
QLTPPNPTTVSSSAVFKEALPPIYPARTIQSAKPEMPANVYITSTPANQTVVQVPSSQYH
QQYYSLSQVPPPSHQMATVPNGAANYGYEYSHPVTKL
Download sequence
Identical sequences K4BM36
Sopim03g118870.0.1 Solyc03g118870.2.1 Solyc03g118870.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]