SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim03g119560.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim03g119560.0.1
Domain Number 1 Region: 120-234
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000318
Family B3 DNA binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sopim03g119560.0.1
Sequence length 246
Sequence
MNITMEDIPINPNWTRLDILAVVCERVLEEEEEIVKETAMHEAESREKLMRVENPNRPID
DQVKTRIKTRKREYDPEDKRRRIIGKKRKKSETGKILPMPQIVKDRINQLEKGVKEVKFI
IEKEIFKTDCGEHQNRLSIPITQVVEKFLTDEEEKYLCMPSNGNRINFKKVRVIDPSLDI
YELELRRWKMTESAIYALNGKWTKMRVRNKIKKGNTIQIWAVRMDDDELIIVIMKLSPDE
KTKVIN
Download sequence
Identical sequences K4BMA5
Solyc03g119560.1.1 Solyc03g119560.1.1 Sopim03g119560.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]