SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim06g053710.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim06g053710.0.1
Domain Number 1 Region: 632-754
Classification Level Classification E-value
Superfamily CheY-like 3.7e-25
Family Receiver domain of the ethylene receptor 0.0068
Further Details:      
 
Domain Number 2 Region: 185-335
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000000323
Family GAF domain 0.0055
Further Details:      
 
Domain Number 3 Region: 353-434
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000785
Family Homodimeric domain of signal transducing histidine kinase 0.0082
Further Details:      
 
Domain Number 4 Region: 433-595
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000129
Family Histidine kinase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sopim06g053710.0.1
Sequence length 761
Sequence
MLRTLASALLVLSFFVSLSAADNGFPRCNCDDEGFWSIESILECQKISDLFIAIAYFSIP
IELLYFVSCSNFPFKWVLFQFIAFIVLCGMTHLLNFWTYYGQHPFQLMLALTIFKVLTAL
VSFATAITLITLFPMLLKVKVREFMLKKKTWDLGREVGLIKMQKEAGWHVRMLTQEIRKS
LDRHTILYTTLVELSKTLDLHNCAVWKPNENKTEMNLIHELRDSSFNSAYNLPIPRSDPD
VIQVKESDGVKILDADSPLAVASSGGSREPGAVAAIRMPMLKVSNFKGGTPELVPECYAI
LVLVLPSEQGRSWCSQEIEIVRVVADQVAVALSHAAILEESQHMRETLEEQNRALEQAKQ
DALRASQARNAFQMVMSHGLRRPMHSILGLLSLLQDEKLGNEQRLLVDSMVKTSNVVSTL
IDDVMDTSTKDNGRFPLEMRYFQLHSMIKEAACLAKCLCAYRGYNISIEVDKSLPNHVLG
DERRVFQVILHMVGNLLKDPNGGLLTFRVLPESVSREGIGGAWRTRRSNSSRDNAYIRFE
VGTSNNHSQPEGTMLPHYRPKRCSKAMDEGLSFTVCRKLVQLMQGDIWVIPNPEGFDQSM
AVVLGLQLRPSIAIGIPEYGESSDHSHPHSLLQGVKVLLADYDDVNRAVTSKLLEKLGCS
VSAVSSGRDCIGVLSPAVSSFQIVLLDLHLPDLDGFEVTMRIRKFGSHNWPLIVGLTATA
DENVTGRCLQIGMNGLIRKPVLLPGIADELQRVLLRGSRMM
Download sequence
Identical sequences Sopim06g053710.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]