SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim07g032110.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim07g032110.0.1
Domain Number 1 Region: 46-257
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.5e-24
Family BAR domain 0.036
Further Details:      
 
Domain Number 2 Region: 267-358
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000021
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sopim07g032110.0.1
Sequence length 370
Sequence
MESIRKQATKLREQVAKQQQAVFKQFSSGLGGPDNSVTDEVELQQHQKLEKLYISTRAGK
HFQRDIIRGVEGYIITASKQIEIGTRLSEDSRKYGAENKCTSGSTLSKAALSYSRAQGEI
EKEREDLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRVRQEAEAQAIEVSRRQAKVR
ESNGNPESVSKMEAAEAKLKDLKSNVATLGKEASTSMAAVEAQQQRLTLQRLIAMVEAQR
HYHERVLQILDQLEAEMMSERQRIEASPSSATDNTMPPPPSYTDVNGGLHFKSYDGSIDG
TTYYLAEVVHPYEAESDVELTLLIGDYVVVRKVSNNGWAEGECKGKGGWFPFGYVERRER
ILATKVAEVF
Download sequence
Identical sequences K4CDF5
Solyc07g032110.2.1 Sopim07g032110.0.1 Solyc07g032110.2.1 XP_004243144.1.44838 XP_015080418.1.21931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]