SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim08g006260.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim08g006260.0.1
Domain Number 1 Region: 8-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.12e-18
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-17
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sopim08g006260.0.1
Sequence length 251
Sequence
MEVTSVQPHFFKPLLPGFKNSLKIPDGFLKYLEGCEEKGRALLKKGGKKWVVKLNGQKLE
EGWGQFAEEHDLKLGDMLIFRHEGDLEFDVTVFNLNHCDREYAEYEEEEEEVRTVEETST
NFEFKEGSTHIPFGQSQFICTVKPYCLRNGYLRVPCKFAKANGLTNKECGLIIRDERQRS
WNLRIYTSCSQVYIGGRWSEFRAANDIKKGDQIMFEVVSNGEQPIWNFHGWQRITTDTIW
CFFVKELWLHL
Download sequence
Identical sequences K4CIB5
Solyc08g006260.1.1 Solyc08g006260.1.1 Sopim08g006260.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]