SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim08g066860.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim08g066860.0.1
Domain Number 1 Region: 304-407
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000301
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sopim08g066860.0.1
Sequence length 415
Sequence
MEKVSSCGVKCKSNRLEGIDEDGATNWLPGACPPPETPTESMEFLARSWSLSAKELSKAL
SHTKQTSYVDEKMSFSSLQGQHGKTSIMEEPQEQPLPNSDSPPVSPRGSDDTKELFLLHQ
ALNSDFLSSHHLLKAGLYRTVMRGKTMGRWLKDQKEKKKQELRTHSAQVHAAVSVAGVAA
AVAALATLSVTSPEQSITKHNTSSKMSTAIASAAALVASHCIEIAEDMGAEQDQILSVVN
SAINARTSGDIMTLTAGAATALRGAATLRARLQKGNGAAAIALADEGVEGNKEATVTAAL
SFVAKGGELLKRTRKGDLHWKQVSFTINSDWQVIAKMKSKHMGGTFTKKKECVVSGVCCD
VPAWLGRDEEHDEQKCYFGIQTADRMIEFECRNKGEKQMWVDGIQQILCCRMTMT
Download sequence
Identical sequences K4CLR2
Solyc08g066860.2.1 Solyc08g066860.2.1 Sopim08g066860.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]