SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim08g074780.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim08g074780.0.1
Domain Number 1 Region: 43-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.62e-24
Family BAR domain 0.05
Further Details:      
 
Domain Number 2 Region: 281-347
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-16
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sopim08g074780.0.1
Sequence length 362
Sequence
MEAIKKQATKLREQVAKQQQAILRQLGHLGHESVMVDEAELEIHQRLQELYMSTRAAKHF
QRDIVRGVEGYISTSKKQVEIARKLVDNCYKYGSEIQNGPSTLPKVAVEFGTTHAAMEDQ
REIMLGVLGSQVCEPLRASIHGAPLEDARHLTHSYDRMRQEFESQATEVIRRQSKFREAS
TESLAKLKNAETRLSELKSSVLVLGKEATDAMLSVEEEQQQITFQKLLTMVDAERSYHQN
VVSILEKLHSEMLVEEQLSESPPQSSNSPRVLHDTTSNGTEHPETEDKSPTYFIAKVMHS
FDAQADGELSLEVGDYVVVRQVAPNGWSEGECNGKSGWFPSAYAVMSDEVAASKMVETDT
TP
Download sequence
Identical sequences K4CMJ6
XP_004246038.1.44838 XP_010325644.1.44838 Sopim08g074780.0.1 Solyc08g074780.2.1 Solyc08g074780.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]