SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim08g080260.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim08g080260.0.1
Domain Number 1 Region: 200-346
Classification Level Classification E-value
Superfamily PH domain-like 3.93e-16
Family Ran-binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sopim08g080260.0.1
Sequence length 349
Sequence
MRGTKRIAPSDSKSFTDDSIQGKRIMGSLFDSQKAEQSQPQKVKAPQLDMQRAESSRQHV
RALNTQFASWVQMQLQNHPDELWEDGIQDYLNHSSTIKEKFTDIVNWLKANSSNGEIKSA
HGSQAALKTLESENKESDGRLSFPKPDTPVANSSSSFGASWNSGSLFSKTTPFSFGLQPS
VQTQNLVPLKTDAANVVQDAEDEVEQPSSPSVKKTEEKGITVVHEVKCKLYVKSTDPVDK
DAWKDRGTGQLSIKCKEGVSKGTRESKPTILIRNDVSSIPFFVGKILLNALLYQGIKTNL
QKNSVVAIFHTSGDGDNDDVVARTFLIRTKTVEDRNKLAAAIQEHAPAA
Download sequence
Identical sequences Sopim08g080260.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]