SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim09g083290.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim09g083290.0.1
Domain Number 1 Region: 109-217
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.5e-22
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim09g083290.0.1
Sequence length 236
Sequence
MDLKETELCLGLPGGGGGGGELIRDNNNNNNKVNGKRGFSETVDLKLNFHQASDDISCAM
ENNKMKSSVTTTKEVVCNKDPIKPPAKAQVVGWPPVRSFRKNVMAQKSNTEESEKTTAAF
VKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTNGNYGSQGMIDFMNESKLMDLLN
SSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRI
Download sequence
Identical sequences G9HPW2
Solyc09g083290.2.1 Solyc09g083290.2.1 Sopim09g083290.0.1 NP_001266070.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]