SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim10g007240.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim10g007240.0.1
Domain Number 1 Region: 369-479
Classification Level Classification E-value
Superfamily TPR-like 1.48e-25
Family Tetratricopeptide repeat (TPR) 0.0026
Further Details:      
 
Domain Number 2 Region: 127-218
Classification Level Classification E-value
Superfamily TPR-like 8.86e-25
Family Tetratricopeptide repeat (TPR) 0.0055
Further Details:      
 
Domain Number 3 Region: 448-579
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000211
Family Thioltransferase 0.0065
Further Details:      
 
Weak hits

Sequence:  Sopim10g007240.0.1
Domain Number - Region: 234-359
Classification Level Classification E-value
Superfamily TPR-like 0.00822
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim10g007240.0.1
Sequence length 594
Sequence
MNSTPLADRMKNDDPRILKLGSTLRTRMSCSTTGSSGQSVSSSGTGNSGSGSSSSSSRVE
IVPAGNICPSGKVITGMRSKPVRTVLSDNEMIPGMYGYGSIMPAGATRRTCGVSSSDTPE
SSLKINSEELKAKGNENYKKGNFLEALYFYDKAIAISPSDGRLRCNRAAALMGLKRMPEA
LKECEEAIRLAPAYVRAHQRLGSLLLSLGHVENARKCLFSLNQIPDEAELHKLETVENHI
NKCTEARRLGEWTSVLKEAEAATSRGAEASAQLFACQAEAHLKLHQLTDAELWMYKAKMY
EASARAYKSKNFGMISEAYILFVQAQIENTLGKFDNACAAIERAAQVDLQSSEVIGLLKN
MRLVGRARSLGNELFKSGRYIEACSAYGEGLSCDSLDPILYCNRAACWYKLKKWEKSLDD
CNRALLIRPQHTKALLRKAASNIKLGRWADAVRDYEILWQELPSSEEVAENLSHARAELT
KSHREGNGMVELVSDVDKFRAAIASGASVVYFHELSDPLCTWKSYVMGTLSAKYHSVIFL
KVDMKQSPAIATAENITVASTFKLYKDGSCKVDMVTATPDLLEFSIRDTLLCPI
Download sequence
Identical sequences K4CXQ4
Sopim10g007240.0.1 Solyc10g007240.1.1 Solyc10g007240.1.1 XP_019071436.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]