SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YAL002W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL002W
Domain Number 1 Region: 57-237,301-405
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000128
Family WD40-repeat 0.045
Further Details:      
 
Domain Number 2 Region: 1181-1270
Classification Level Classification E-value
Superfamily RING/U-box 0.0000238
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YAL002W
Sequence length 1274
Comment VPS8 ORF Verified Membrane-associated protein that interacts with Vps21p to facilitate soluble vacuolar protein localization; component of the CORVET complex; required for localization and trafficking of the CPY sorting receptor; contains RING finger motif
Sequence
MEQNGLDHDSRSSIDTTINDTQKTFLEFRSYTQLSEKLASSSSYTAPPPNEDGPKGVASA
VSQGSESVVSWTTLTHVYSILGAYGGPTCLYPTATYFLMGTSKGCVLIFNYNEHLQTILV
PTLSEDPSIHSIRSPVKSIVICSDGTHVAASYETGNICIWNLNVGYRVKPTSEPTNGMTP
TPALPAVLHIDDHVNKEITGLDFFGARHTALIVSDRTGKVSLYNGYRRGFWQLVYNSKKI
LDVNSSKEKLIRSKLSPLISREKISTNLLSVLTTTHFALILLSPHVSLMFQETVEPSVQN
SLVVNSSISWTQNCSRVAYSVNNKISVISISSSDFNVQSASHSPEFAESILSIQWIDQLL
LGVLTISHQFLVLDPQHDFKILLRLDFLIHDLMIPPNKYFVISRRSFYLLTNYSFKIGKF
VSWSDITLRHILKGDYLGALEFIESLLQPYCPLANLLKLDNNTEERTKQLMEPFYNLSLA
ALRFLIKKDNADYNRVYQLLMVVVRVLQQSSKKLDSIPSLDVFLEQGLEFFELKDNAVYF
EVVANIVAQGSVTSISPVLFRSIIDYYAKEENLKVIEDLIIMLNPTTLDVDLAVKLCQKY
NLFDLLIYIWNKIFDDYQTPVVDLIYRISNQSEKCVIFNGPQAPPETTIFDYVTYILTGR
QYPQNLSISPSDKCSKIQRELSAFIFSGFSIKWPSNSNHKLYICENPEEEPAFPYFHLLL
KSNPSRFLAMLNEVFEASLFNDDNDMVASVGEAELVSRQYVIDLLLDAMKDTGNSDNIRV
LVAIFIATSISKYPQFIKVSNQALDCVVNTICSSRVQGIYEISQIALESLLPYYHSRTTE
NFILELKEKNFNKVLFHIYKSENKYASALSLILETKDIEKEYNTDIVSITDYILKKCPPG
SLECGKVTEVIETNFDLLLSRIGIEKCVTIFSDFDYNLHQEILEIKNEETQQKYLDKLFS
TPNINNKVDKRLRNLHIELNCKYKSKREMILWLNGTVLSNAESLQILDLLNQDSNFEAAA
IIHERLESFNLAVRDLLSFIEQCLNEGKTNISTLLESLRRAFDDCNSAGTEKKSCWILLI
TFLITLYGKYPSHDERKDLCNKLLQEAFLGLVRSKSSSQKDSGGEFWEIMSSVLEHQDVI
LMKVQDLKQLLLNVFNTYKLERSLSELIQKIIEDSSQDLVQQYRKFLSEGWSIHTDDCEI
CGKKIWGAGLDPLLFLAWENVQRHQDMISVDLKTPLVIFKCHHGFHQTCLENLAQKPDEY
SCLICQTESNPKIV
Download sequence
Identical sequences YAL002W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]