SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBL104C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL104C
Domain Number 1 Region: 43-86,146-331,361-394
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000641
Family WD40-repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YBL104C
Sequence length 1038
Comment ORF Uncharacterized Putative protein of unknown function, promoter contains multiple GCN4 binding sites
Sequence
MGLIKKVTHWSYDNLIDYLSVNPTRDEVTHYKVDPENESDESIIKLHTVKDFGSITCLDY
SESEIGMIGVGEKNGYLRIFNISGQNSSSPASHAPVGLNANNETSMTNASGGKAAQAENI
VGSVSNLKDTQGYPVSETNYDIRVRAKKQRCINSLGINTNGLIAMGLDRNKHDSSLQIWD
MNYHDDSHETINPMFSYCTNESIVSLKFLNDTSVLAASTKFLKEIDVRSPNPIYQHPTRL
TYDIKLNPFNDWQFSTYGDDGTLAIWDRRKLSDQASLGDLNVASPLLTFEKLVGSGAASR
KYMNSCFRWSCVRNNEFATLHRGDTIKRWRLGYYCDSNRDIAADDDNEMNIENLFVSSVH
DTNTMYDRVATFDYIPRSNNGTSLICMRQSGTIYRMPISEVCSKAILNNRNSLLLSNFEN
TEIDEIRVNNEHEKSNLENVKTVLKNLSFEDLDVSEDYFPSGHDEPNNEIEYSELSEEEN
EGSNDVLDSKRGFELFWKPEKLLEKDISVIMRTRASLGYGLDPMNTVEMIDSSKNLQNNA
YIRNTWRWIAIAKASVDDGTMVSGDLDLGYEGVIGIWNGINGISNQDRYRQETILSDKQL
NKEMEKIIKLRRKNRDRNSPIANAAGSPKYVQRRLCLIISGWDLSRSDYEDKYNIIMKNG
HYEKAAAWAVFFGDIPKAVEILGSAKKERLRLIATAIAGYLAYKDLPGNNAWRQQCRKMS
SELDDPYLRVIFAFIADNDWWDILYEPAISLRERLGVALRFLNDTDLTTFLDRTSSTVIE
NGELEGLILTGITPNGIDLLQSYVNKTSDVQSAALISIFGSPRYFRDQRVDEWIQTYRDM
LKSWELFSMRARFDVLRSKLSRTKTGVLTADIKPRQIYIQCQNCKQNINTPRTSSPSSAV
STSAGNYKNGEAYRRNNADYKKFNTGSSEAQAADEKPRHKYCCPHCGSSFPRCAICLMPL
GTSNLPFVINGTQSRDPMQTEDSQDGANRELVSRKLKLNEWFSFCLSCNHGMHAGHAEEW
FDRHNVCPTPGCTCQCNK
Download sequence
Identical sequences A0A0L8VVS5 A0A250WF55 A6ZKK0 B3LNN4 G2W8R0
YBL104C SCRT_03062 YBL104C YBL104C YBL104C tr|A6ZKK0|A6ZKK0_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]