SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR195C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR195C
Domain Number 1 Region: 125-162,199-414
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.01e-42
Family WD40-repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YBR195C
Sequence length 422
Comment MSI1 ORF Verified Subunit of chromatin assembly factor I (CAF-1), negative regulator of the RAS/cAMP pathway via sequestration of Npr1p kinase; localizes to the nucleus and cytoplasm; homologous to human retinoblastoma binding proteins RbAp48 and RbAp46
Sequence
MNQCAKDITHEASSIPIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSD
EHRILLSSFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLV
NDISIFFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKL
FGSHGVIQDVEAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPII
DLPLVSINSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVN
SCRFNYKNSLILASADSNGRLNLWDIRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAG
QEDGLVKLWDTSCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAGNLVG
HS
Download sequence
Identical sequences N1P6Y4 P13712
4932.YBR195C NP_009754.1.97178 YBR195C YBR195C YBR195C YBR195C YBR195C YBR195C YBR195C YBR195C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]