SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR234C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR234C
Domain Number 1 Region: 20-294,336-383
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.3e-34
Family WD40-repeat 0.00000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YBR234C
Sequence length 384
Comment ARC40 ORF Verified Subunit of the ARP2/3 complex, which is required for the motility and integrity of cortical actin patches
Sequence
MSFSNSKDKSVVAVYKLVKAPIYSHCFSQDKSILAVTCETDCLVYRVSNNTPPVLFATLK
DHDKTITAVDISIHGRIVTCSQDRNAYVWEPLSDGTYKPTLVLLRINRAATSVTWAPNGY
KFAVGSSARIIAVCYYEHENNWWVSKHIKKPIKSTINCLSWHANGVLLAAGGTDGFMRVF
SGFIKGLDSKESVAGSPWGQKFPFGCLIREWYQGSYIHDVEWRSQMERIAYVAHDGTLNV
VDYQSPVQSVNAPEGLPYRSLVWINDHEIVCGGYSCHPVLFSEASEGWKFAKNLDKSDNN
KSSALTASGNTDELSGNNDESSTFGISALRKFKELDLKGKVSTDVQESAHENAIVELRPF
AESNGQITQVSSCGLDGKIVIYTI
Download sequence
Identical sequences A6ZLH3 E7NF38 E7Q192 G2W9N7 P38328
YBR234C 4932.YBR234C YBR234C tr|A6ZLH3|A6ZLH3_YEAS7 YBR234C YBR234C YBR234C YBR234C YBR234C YBR234C YBR234C YBR234c___KOG1523 NP_009793.1.97178 YBR234C YBR234C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]