SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCL028W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YCL028W
Domain Number - Region: 5-37
Classification Level Classification E-value
Superfamily TPR-like 0.0337
Family Tetratricopeptide repeat (TPR) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YCL028W
Sequence length 403
Comment RNQ1 ORF Verified [PIN(+)] prion, an infectious protein conformation that is generally an ordered protein aggregate
Sequence
MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIAGYVMDNRSGG
SDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATVMTHSSNKGSSNRGFDVGTVM
SMLSGSGGGSQSMGASGLAALASQFFKSGNNSQGQGQGQGQGQGQGQGQGSFTALASLAS
SFMNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSYQNGNQNSQ
GYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQSNQQQYNQQGQNNQQQYQ
QQGQNYQHQQQGQQQQQGHSSSFSALASMASSYLGNNSNSNSSYGGQQQANEYGRPQHNG
QQQSNEYGRPQYGGNQNSNGHHESFNFSGNFSQQNNNGNQNRY
Download sequence
Identical sequences K4HWU0
YCL028W YCL028W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]