SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCR032W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR032W
Domain Number 1 Region: 1541-1839
Classification Level Classification E-value
Superfamily BEACH domain 3.79e-122
Family BEACH domain 0.0000000473
Further Details:      
 
Domain Number 2 Region: 1372-1499
Classification Level Classification E-value
Superfamily PH domain-like 1.19e-21
Family PreBEACH PH-like domain 0.025
Further Details:      
 
Domain Number 3 Region: 1918-2105
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000084
Family WD40-repeat 0.018
Further Details:      
 
Weak hits

Sequence:  YCR032W
Domain Number - Region: 242-358
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000125
Family Glycosyl hydrolases family 16 0.064
Further Details:      
 
Domain Number - Region: 615-830
Classification Level Classification E-value
Superfamily ARM repeat 0.0155
Family HspBP1 domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YCR032W
Sequence length 2167
Comment BPH1 ORF Verified PProtein homologous to human Chediak-Higashi syndrome and murine Beige proteins, which are implicated in disease syndromes due to defective lysosomal trafficking; mutant phenotype and genetic interactions suggest a role in protein sorting
Sequence
MNSIINAASKVLRLQDDVKKATIILGDILILQPINHEVEPDVENLVQHELTKIIQGYPIQ
DSMIINSKKGTVEDDLCELNNYTCFALSKSFDLCHDSRNFNIAQPKRWIQLLETLTDSVS
FAVIVQIILTLSNISLINKQTLGKLKKLRIRIFEILSNKNDSWKSTLLQKNLIEWYIFML
SVDCTPLELQNLYLHKELKFCNDILNSLTLQVSDPRSQNYLQFENTYKLFQIQKSSRINN
SFLFYIEFNSVTSNRIMTIERHIYLEIKEGQFCISNDNYIIGLFENFEFEAGTLYFIGVL
IDHNNRITLYVDGSMINQLTLFENSICQLSTCELGSMICSIKVYRFYLWDGLLTEFAINI
LQAIGTNYQYTFSKKKEGPEVLSLCQDFLIAKAHLMARPATEISSTKYIDEIELLEMENI
IIDVNPNDILQDFTESSNFTVKFEESTNSKNIPEVGKCYFYRSSNLVSKFVSIDSIRLAF
LNMAESGSIDDLFHHVSHLMNLLRNIDILNWFKKDFGFPLFAYTLKQKITQDLSQPLNIQ
FFNLFLEFCGWDFNDISKSIILDTDAYENIVLNLDLWYMNEDQSSLASGGLEIIRFLFFQ
ISSLMEASIYSKFNSNKFNDMNILEKLCLSYQAVTKRENQNSKFNELSNDLISVFVTLLK
SNTDKRHLQWFLHLSYYFIKRKDVRSTEIILQAVDQLFSFYLDQGSDENAKILSEIIPLK
LMLMIMDQIVENNESNPITCLNILFKVVLTNKPLFKQFHKNDGLKLILTMLCKVGKSYRE
EIISLLLTYSIGNYTTANEIFSGAEDMIGGISNDKITAKEIIYLAVNFIEWHVINSNASD
SSSVLDLNNHILRFVEDLKSLSAVPINESVFDPKKSYVTVSLLDLSIALNESEDISKFKS
SSKVISELIKGNIMCALTKYAAYDFEVYMSTFFCHSTEYKLVYPKTVMNNSSYLELSFIV
TLLPEILNDLVDSNNNLNLMMLKHPYTMSNLLYFLRKFRPDTSQIVMPKDFYFSSYTCLL
HCVIQIDKSSFYHFKNVSKSQLLQDFKICIMNLIYSNTLKQIIWEKEEYEMFSESLMAHQ
EVLFAHGACDNETVGLLLIFFANRLRDCGYNKAVFNCMKVIIKNKERKLKEVACFFDPAN
KSEVLEGLSNILSCNNSETMNLITEQYPFFFNNTQQVRFINIVTNILFKNNNFSPISVRQ
IKNQVYEWKNARSEYVTQNNKKCLILFRKDNTSLDFKIKKSISRYTYNLKTDREENAVFY
RNNLNLLIFHLKHTLEIQSNPNSSCKWSLDFAEDFDGMKRRLLPAWEPKYEPLINEEDAN
QDTITGGNRQRRESGSILSYEFIEHMETLESEPVGDLNENRKILRLLKDNDSIATIWNCS
LIIGLEIKEGILIHGSNYLYFVSDYYFSLEDKKILKLSEVSQESRDMTVSLINGPDVKRV
STFLKHEVFVWKLLDITFVTKRPFLLRDVAIELLFKERVSAFFSFYNKRVRDDVLRVLNK
IPKHLPADPIFSSVLQEINDRGNSIVARNGIGKASIASKFTSVFSANNSLIDGFEISKKW
VRGEISNFYYLLSINILAGRSFNDLTQYPVFPWVIADYESNVLDLENPKTYRDLSKPMGA
QSEKRKLQFIERYEALASLENADSAPFHYGTHYSSAMIVSSYLIRLKPFVESFLLLQGGS
FGPADRLFSSLERAWSSASSENTTDVRELTPEFFFLPEFLINVNSYDFGTDQSGKKVDDV
VLPPWANGDPKVFIQKNREALESPYVSAHLHEWIDLIFGYKQKGEIAVKSVNVFNRLSYP
GAVNLDNIDDENERRAITGIIHNFGQTPLQIFQEPHPEKIACNVQQLTTEVWRKVPMKPI
FEKTIFNLNEKNRSVDYVIHDPSYFDSLYWRGFAFPNLFFRTEESLVSLRIVHKNWLKIG
LDIFKKTHMAEITSFAYWKLGEFITGDKNGLIKVWKYRKDKHSVSGNLENKKTMFGHLCE
LKEMRCYHDYNTLLTLDISGLVYVWDMINFELVRQITNDAQKVAISQHTGSIMVLTKNNA
ISIFNLNGQIYTSKEFEPAKIVSSIDFFDFTKLDAGYRKHIYWKEMEILLVGFEDGTIEI
YELFLTFHNEWAIKLLKQLCTERGKAITSIKGQGKTYLSQKRRKDTAEPHEIEVIAGTLD
GRLAIWY
Download sequence
Identical sequences YCR032W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]