SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCR067C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR067C
Domain Number 1 Region: 11-334
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.13e-24
Family Cell cycle arrest protein BUB3 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YCR067C
Sequence length 1080
Comment SED4 ORF Verified Integral endoplasmic reticulum membrane protein, functions as a positive regulator of Sar1p probably through inhibition of GTPase activation by Sec23p; binds Sec16p, participates in vesicle formation, similar to Sec12p
Sequence
MSGNSANYDVGYPIYGAKFINEGTLLVAGGGGQFNSSFPNKITALKVNFQKKKHIRRFRE
ITLDSIDDAPTSLDCNNNLILVGCNELFNDSSMENVNHHLRKFVFEQEHLKFVASIDFNR
TTDPSVFTKFVYINQRATVAAIASSEVPTVIRIIDPRNLTENYEIETGREVNDLHFAPNG
ILLSYITSNSLEVASVRDGNFVARKTDFDKNLVLSNIRFLNDNTLLVAASLSNSDGVSLL
KLGVSSKGVKILKTASFMFDLNGITSMDVSPNKKFVALSSNDNSVAIVSVEKLKLVQLVP
RVHESTITKVTFSPDSRYLASTSMGNTINVLKLSGTSSSILRNIWKFFLNFVLLVVLAGA
IQLGYKHNVHGFIYKHAHDIYKSKFKENTTIDQGSSSYFTINDDYRGITESADIISAKDI
TSDIETEFSSFDTSTMRTTTEDEQKFVWISSSADSQFTSADIPTSASSSSSTSSSSTYSS
SFYEDSVTNEPIVSSPTSEITKPLASPTEPNIVEKSSLPLNSESIDLLSSSSNSITEYPE
PTPDLEEQLSSLIVEQSESEITTDRESVSRPLSSESLSLSHMPSSSSSSLSLSSSSTTSP
TTALSTSTATAVTTTQTNSTNDAANTSFLDNSKPASTREIYKTKIITEVITKIEYRNIPA
SDSNAEAEQYVTTSSSMLLTPTDTMVSSPVSEIDPIASELERMVETPTHSISIASEFDSV
ASNLIPNEEILSTSASQDSISSHPSAFSDSSITSGFQSIEVSTVTSSVLASESIPSISDS
TFSKFHSISEPVSSAIVETATSSFSKTETETSRVIAFSTEDSERSSALIDNSEYTSVLAD
NSEPTSVLADNLEPTSVLADNSEPTSVLADSSEPTSVFTDAVQSPKTSVGQSSLSEFTNI
EGTSTASMIFSSSGASIGALSDIGKGTLSVESASSTVAQPMPGVTTTAPSFVSSPHKISA
SSIDASRFVQKEIMIEVQSSKDSSEAFGVRHKISENVNTPVSQMLTTEMQASGTVDVTED
VSLSSEVISALNVEITSLPNPVAPPQTIAAPLNNNSNTNIVNDDNAVAGTVNYAGLHDEL
Download sequence
Identical sequences YCR067C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]