SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL145C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL145C
Domain Number 1 Region: 3-170,201-318
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.67e-75
Family WD40-repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 445-598
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000243
Family YVTN repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDL145C
Sequence length 1201
Comment COP1 ORF Verified Alpha subunit of COPI vesicle coatomer complex, which surrounds transport vesicles in the early secretory pathway
Sequence
MKMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLD
FHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIR
IWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSS
FEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSA
TKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWL
IAAHPHINLFGAAHDSGIMVFKLDRERPCSFIHQNQLFFVNAEKQIQSFNFQKRVASLPY
ASLKGIGQPWDAFRSISYNPSQHSVLVNEANGKFALVILPKQPVGAVEPTSVTQDTGNFA
TFVGRNRFVVYNKNTESVEVRSLENKVTRNIKVEETVRTIVAAGPGSVLVIHPREVILYD
VQQGKKVSQLAVKNVKYVSWSLDGQYVALMSKHTITLATKKLELINSMHETIRIKSAAWD
ETGVLIYSTLNHIRYSLLNGDRGIIKTLEKTLYITKVQGKLVYCLNREGEIEILTIDPTE
YRFKKALVNKNFPEVLRLIKDSNLVGQNIISYLQKSGYPEIALQFVQDPHIRFDLALEYG
NLDVALDEAKKLNDSSTWERLIQEALAQGNASLAEMIYQTQHSFDKLSFLYLVTGDVNKL
SKMQNIAQTREDFGSMLLNTFYNNSTKERSSIFAEGGSLPLAYAVAKANGDEAAASAFLE
QAEVDEQDVTLPDQMDASNFVQRPVISKPLEKWPLKEAELSYFEKAVLGQIDDLTIDDET
PAVNTTQEQEEPLGEENFNDEDIGEDEGAWDLGDEDLDVGEELPEEVEQGEITSPAQEVE
TAIWIKNSKLPAVLVAAGAFDAAVQALSKQVGVVKLEPLKKYFTNIYEGCRTYIPSTPCE
LPAQLGYVRAYDDTVSEDQILPYVPGLDVVNEKMNEGYKNFKLNKLDIAIECFREAIYRI
TLLMVDDAEDEKLAHKILETAREYILGLSIELERRSLKEGNTVRMLELAAYFTKAKLSPI
HRTNALQVAMSQHFKHKNFLQASYFAGEFLKIISSGPRAEQARKIKNKADSMASDAIPID
FDPYAKFDICAATYKPIYEDTPSVSDPLTGSKYVITEKDKIDRIAMISKIGAPASGLRIR
V
Download sequence
Identical sequences C7GKZ6
YDL145C YDL145C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]