SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL156W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL156W
Domain Number 1 Region: 185-518
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.17e-36
Family WD40-repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDL156W
Sequence length 522
Comment ORF Uncharacterized Putative protein of unknown function; protein sequence contains three WD domains (WD-40 repeat); green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus
Sequence
MPELTEFQKKRLENIKRNNDLLKKLHLSGVASQIKHEAGVLEKSRAPAKKKQKTTNTRAT
KSASPALPTRRSRRLRGESADDVKGIPNVNDNQLLKMGSPDGQDKNFIDAIKEKPVIGDV
KLSDLIKDEDESALLEKFKRFNNGNFSSGDFFEEIKKRQGDVTGMDEFDLDLYDVFQPNE
IKITYERISATYFHPAMEKKLIIAGDTSGTVGFWNVRDEPLADSEEDRMEEPDITRVKLF
TKNVGRIDCFPANTSKILLTSYDGSIRSVHLNNLQSEEVLTLKNEYDDSLGISDCQFSYE
NPNVLFLTTLGGEFTTFDTRVKKSEYNLRRLADKKIGSMAINPMRPYEIATGSLDRTLKI
WDTRNLVEKPEWSQYEDYPSHEIVSTYDSRLSVSAVSYSPTDGTLVCNGYDDTIRLFDVK
SRDHLPAKLEPKLTIQHNCQTGRWTSILKARFKPNKNVFAIANMKRAIDIYNSEGQQLAH
LPTATVPAVISWHPLRNWIAGGNSSGKIFLFTDDSGTIKQEE
Download sequence
Identical sequences YDL156W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]