SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR030C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR030C
Domain Number 1 Region: 59-92,185-327,357-455
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.57e-34
Family WD40-repeat 0.0045
Further Details:      
 
Weak hits

Sequence:  YDR030C
Domain Number - Region: 49-149
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0288
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR030C
Sequence length 506
Comment RAD28 ORF Verified Protein involved in DNA repair, related to the human CSA protein that is involved in transcription-coupled repair nucleotide excision repair
Sequence
MDPFLEFRLGNISLNEFYRRTIQSEFERILEDPLSNMKNYRFSKQSNYSTKEKTPLSIGV
NCLDIDDTGQVLLGGGDDGSLSIWGLDESLHRNDEGEQELINKRLNYIKRQPHQSDDEPA
QIMGYKNKRTRIDDNNTMRLVHSFQTQRNKYRMYRQSSAAVPVQRSHISNKTDSPIGFSE
TLSETDSEASISHHKYGITTLKWYKADNGMFFTGSNDKTVKIWDTNRFEAVQDINLGYKI
NQIDNNVVDDSSLLVVASEDYYPRLIDLRTMNSGVTALGMGNQTRMQSEILCCKFNPVRE
QIIACGDMEGGVKLWDLRMRNRLYSELKRNKNGFKTINNDDNDDQSDVYFSSNQSKAHLR
CCSDIVWNSEGSELCSVGMDGKLNVWRPFTEILQPEGLASYSQLGTQDLSRIKYKKRVSR
RLLWFDKFLLCITDNGEIEIYNTEEKKLWNKLEYPMVNQVKKNQASHCQFSSMIVQTNIM
NSVGLKLFFGTNNNTVSDGGSIFECS
Download sequence
Identical sequences YDR030C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]