SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR128W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR128W
Domain Number 1 Region: 24-341
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.29e-40
Family WD40-repeat 0.00073
Further Details:      
 
Domain Number 2 Region: 462-521
Classification Level Classification E-value
Superfamily UBC-like 0.0000132
Family UBC-related 0.033
Further Details:      
 
Weak hits

Sequence:  YDR128W
Domain Number - Region: 1095-1129
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00126
Family C1-like domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR128W
Sequence length 1148
Comment MTC5 ORF Verified Protein of unknown function; mtc5 is synthetically sick with cdc13-1
Sequence
MCSSINEGPYNSPTFGKSLSLKVDGGFNAVSINPSGRDIVLASRQGLYIIDLDDPFTPPR
WLHHITPWQVADVQWSPHPAKPYWIVSTSNQKAIIWNLAKSSSNAIEFVLHGHSRAITDI
NFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVLASSHGN
DIFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKYSEIMSSSNDGTVKFWDYSKSTTESKR
TVTTNFPIWRGRYLPFGEGYCIMPMVGGNNAVYLVNLCDDDDSEQNKKTKLQPIYAFKGH
SDRVIDFLWRSRHTYDGDYDDREFQLVTWSKDCDLKLWPISDSIYGKVNFDRGKRLEEKL
PDYDYCSYNKEPENRENVQKNEFRRLRENFVTTSGLKKNKTNHITWLSGIRMNSATSQED
LFNETKIQNLGEEVSAIGHKFPKVVFEKISVSTRELCLTLNGPWSEENPDDYIFLRISIN
FPPNYPNKGNPPKFTIEENSNLTMSKRQEILSNLATIGQKYTDSNLYCLEPCIRFVLGEK
VSLEDIEEGQEPLLNFDIADHIDFEELSSLDSSYSDSQNPENLSSQSDTESYKEALVFPD
TSNQGLDFGRNLALDTTPVPNGCGSCWTATGELFCFFANEKKPEKKQNAIIKLSQKEAGV
EKHPFKIEPQVLYDKEVDSSVITAADELKARPKRYVDTLGLGGGTNGDSRTYFDDETSSD
DSFDSVADDWDDILRNDIIVRTKIPILRGNFKAFSSVHSESGKTVESTKKNKNLVISKNF
SSLLSDRKELALEYLFMDATPEEFARNNALVAEKFDLDEISHCWQILSDMLIDQSDYDPY
TTIWNNHPMGIKWFIKEAIVYFERQQNLQMLAMLCCVILSARRKKIPARYYGQELENMEG
TIVFNDNESQNTSFWKGSDAFSTRSRSSTVTPNFYGNHLRGKNIHGGDNSSIRSDDHHAR
LRTHNTLNGSSKFTEPAQKQGSRAISSSPFHSRMPDIKVELLHDDIIEAYEQEDLLHLEV
SDIPKFQTYIYQYSKLLFRWGLPLERVKILKVSTDFRSSYSSQGIPPNNNKKSPYNGVLT
HWIENNEFGEEKFLARNCNYCDLRVTRSSFICGNCQHVLHSSCARIWWEIGDECPSGCGC
NCPEMFDA
Download sequence
Identical sequences YDR128W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]