SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR165W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR165W
Domain Number 1 Region: 8-35,100-279
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.15e-20
Family WD40-repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR165W
Sequence length 444
Comment TRM82 ORF Verified Subunit of a tRNA methyltransferase complex composed of Trm8p and Trm82p that catalyzes 7-methylguanosine modification of tRNA
Sequence
MSVIHPLQNLLTSRDGSLVFAIIKNCILSFKYQSPNHWEFAGKWSDDFDKIQESRNTTAK
EQQGQSSENENENKKLKSNKGDSIKRTAAKVPSPGIGAPPIYSYIRNLRLTSDESRLIAC
ADSDKSLLVFDVDKTSKNVLKLRKRFCFSKRPNAISIAEDDTTVIIADKFGDVYSIDINS
IPEEKFTQEPILGHVSMLTDVHLIKDSDGHQFIITSDRDEHIKISHYPQCFIVDKWLFGH
KHFVSSICCGKDYLLLSAGGDDKIFAWDWKTGKNLSTFDYSSLIKPYLNDQHLAPPRFQN
ENNDIIEFAVSKIIKSKNLPFVAFFVEATKCIIILEISEKQKGDLALKQIISFPYNVISL
SAHNDEFQVTLDNKESSGVQKNFAKFIEYNLNENSFVVNNEKSNEFDSAIIQSVQGDSNL
VTKKEEIYPLYNVSSLRKHGEHYS
Download sequence
Identical sequences A0A250W8T3 A6ZYC3
sp|A6ZYC3|TRM82_YEAS7 YDR165W YDR165W YDR165W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]