SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR488C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR488C
Domain Number 1 Region: 269-518
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000116
Family WD40-repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR488C
Sequence length 532
Comment PAC11 ORF Verified Dynein intermediate chain, acts in the cytoplasmic dynein pathway, forms cortical cytoplasmic microtubule capture site with Num1p; null mutant is defective in nuclear migration, essential in the absence of CIN8
Sequence
MERLKQLEEKRRQLKELRERRKQASLFPGSETMGHHPTEVHAKATMVSVSVQTDMEEGSK
IQEPQSAYLRRKEVITYDKGIQTDQIEEEQLQENENHTTTDTVAIETTAADENNNDKAEN
DQPRLELAKPFLVEEAAATLSNASFARLEAEVSASGQQAPSNMQQDKDNLMQWNMVSENL
KSETDCDCIAQEYDPGKGVLVVVYLRLPPADLQYASSEAAWSVVNVVKCDNASGRNGLLI
DMVEFRGTRIMTATILRRYHPESNVISILLATFTGKIILYELRLKQKKPETPVVYVVQRN
MVARHYFQHPVVAVIETSSVQDQERVLVAADNGNIMELSCLDLTVLRKPQQLRPVPLSQL
LSLENDTCTYTERLQRLAKFDEVGIACMAYTSEDPQYVWIGGEDGGIYKVFWDQPGPLYL
SLDNNGFQPAENHSTRVTGLEFHWDDARRLMLLLSCSTDWTVRLWDARAGKAIIGAPLLL
GGPVLRARWLEHNGGENSRTLRCQVWCADGRLVVVNWAFDAKTSLYTATVIS
Download sequence
Identical sequences YDR488C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]