SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER066W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER066W
Domain Number 1 Region: 2-176
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-25
Family WD40-repeat 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YER066W
Sequence length 185
Comment RRT13 ORF Uncharacterized Putative protein of unknown function; non-essential gene identified in a screen for mutants with decreased levels of rDNA transcription
Sequence
MKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCA
KILGAMYTLRGHRALVGLLGLSDKFLVSASADGSIRCWDANTYFLKHFFDHTQLNTITAL
HVSDEVLVSGSEGLLNIYDLNSGLLVRSDTLSGADNVWNVSFKDNTLVAAVERDKLNLLE
ILDFS
Download sequence
Identical sequences YER066W YER066W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]