SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER107C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER107C
Domain Number 1 Region: 35-332
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.72e-50
Family Cell cycle arrest protein BUB3 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YER107C
Sequence length 365
Comment GLE2 ORF Verified Component of the Nup82 subcomplex of the nuclear pore complex; required for polyadenylated RNA export but not for protein import; homologous to S. pombe Rae1p
Sequence
MSFFNRSNTTSALGTSTAMANEKDLANDIVINSPAEDSISDIAFSPQQDFMFSASSWDGK
VRIWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMH
SAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPERVYSMDNKQSLLV
VATAERHIAIINLANPTTIFKATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDG
MQKKSGFSFKCHRQTNPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQ
RHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYPNVIRLHATTDEEVK
EKKKR
Download sequence
Identical sequences A0A0L8VRL5 A0A250WJX3 A6ZR63 B3LRM4 C7GS78 C8Z7C5 E7KMR8 E7LTJ0 E7NGV7 E7QE02 G2WD16 P40066
SCRT_04585 YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C YER107C NP_011033.3.97178 YER107C YER107C YER107C YER107C 4932.YER107C YER107C tr|A6ZR63|A6ZR63_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]