SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YFL023W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFL023W
Domain Number 1 Region: 10-117
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000314
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YFL023W
Sequence length 807
Comment BUD27 ORF Verified Unconventional prefoldin protein involved in translation initiation; mutants have inappropriate expression of nutrient sensitive genes due to translational derepression of Gcn4p transcription factor; diploid mutants show random budding
Sequence
MDLLAASVESTLKNLQDKRNFLSEQREHYIDIRSRLVRFINDNDDGEEEGEGQGMVFGDI
IISTSKIYLSLGYEYYVEKTKEEAITFVDDKLKLMEDAIEQFNLKIEEAKKTLDNLNHME
DGNGIDEDEANNDEDFLPSMEIREELDDEGNVISSSVTPTTKQPSQSNSKKEQTPAVGPK
EKGLAKEKKSKSFEENLKGKLLKRNDEVKKKVQPSKVDTENVYTFADLVQQMDQQDELED
GYIETDEINYDYDAFENSNFKVNEYNYEEDDEDEDEEEYLNHSIIPGFEAQSSFLQQIQR
LRAQKQSQDHEREEGDVNKSLKPILKKSSFAENSDKKQKKKQVGFASSLEIHEVENLKEE
NKRQMQSFAVPMYETQESTGIANKMTSDEFDGDLFAKMLGVQEADEVHEKYKEELINQER
LEGEASRSNRRTRVSRFRKDRASKKENTLSTFKQETTRSVENEVVEKEPVVGDIIEKEPV
VGDVIEKEPAVTDIVEKEPAVTDIVEKEPVINDIVEKEPAVNDIVEREPVVGDIIEKEPA
VNDIVEKEPEINSKSEFETPFKKKKLKSLQKPRSSKSMKKKFDPKILEIISDDDYDDDDD
GNKKLLSNKSKSNTDEQDKFPSKIQEVSRSMAKTGATVGSEPVRITNVDYHALGGNLDDM
VKAYSLGLYDDDLEEDPGTIVEKLEDFKEYNKQVELLRDEIRDFQLENQPVTMEEEENDG
NVMNDIIEHEFPESYTNDEDEVALHPDRLQEEVAIEYRRLKEATASKWQSSSPAAHTEGE
LEPIDKFGNPVKTSRFRSQRLHMDSKP
Download sequence
Identical sequences YFL023W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]