SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL100W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL100W
Domain Number 1 Region: 7-247,294-333
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.78e-43
Family WD40-repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YGL100W
Sequence length 349
Comment SEH1 ORF Verified Nuclear pore protein that is part of the evolutionarily conserved Nup84p complex (Nup84p, Nup85p, Nup120p, Nup145p, and Seh1p); homologous to Sec13p
Sequence
MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVA
IDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAH
LGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSP
EKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRI
RIFKITEKLSPLASEESLTNSNMFDNGADVDMDAQGRSDSNTEEKAELQSNLQVELLSEH
DDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQQ
Download sequence
Identical sequences A0A0L8VQQ8 A0A250WBZ7 A6ZU80 B3LHG5 B5VIM5 C7GM18 E7KCG3 E7LUB4 E7QEP1 G2WDZ9
YGL100W tr|A6ZU80|A6ZU80_YEAS7 YGL100W YGL100W YGL100W YGL100W YGL100W YGL100W YGL100W YGL100W SCRT_01098 YGL100W YGL100W YGL100W YGL100W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]